SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE14681_5prime_partial:A_BomoEE_comp67876_c0_seq2
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
PREDICTED:_protein_spinster_isoform_X2_[Plutella_xylostella]
Ontology
GO:0003376 P sphingosine-1-phosphate receptor signaling pathway
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0006897 P endocytosis
GO:0007040 P lysosome organization
GO:0007275 P multicellular organism development
GO:0007422 P peripheral nervous system development
GO:0007619 P courtship behavior
GO:0008333 P endosome to lysosome transport
GO:0008347 P glial cell migration
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0009267 P cellular response to starvation
GO:0010001 P glial cell differentiation
GO:0012501 P programmed cell death
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030154 P cell differentiation
GO:0031902 C late endosome membrane
GO:0031982 C vesicle
GO:0035193 P larval central nervous system remodeling
GO:0040011 P locomotion
GO:0043067 P regulation of programmed cell death
GO:0045476 P nurse cell apoptotic process
GO:0045477 P regulation of nurse cell apoptotic process
GO:0045924 P regulation of female receptivity
GO:0046624 F sphingolipid transporter activity
GO:0048477 P oogenesis
GO:0048488 P synaptic vesicle endocytosis
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0055085 P transmembrane transport
GO:0090099 P negative regulation of BMP signaling pathway
RNA-seq EntryA_BomoEE_comp67876_c0_seq2
Sequence
(Amino Acid)
VADADPLLCGAALLLSAPLVFCALIAVRASAAGTFALIFFGMLTLNLTWSVVADMILVSG
RPPPETDFSAYKYSNEIRRYAGALRGRLRRLDIVNAASL
*(32 a.a.)

- SilkBase 1999-2023 -