SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1467_complete:A_BomoEE_comp31347_c0_seq1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		atonal_[Bombyx_mori]
Ontology
GO:0000187 P obsolete activation of MAPK activity
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001745 P compound eye morphogenesis
GO:0001746 P Bolwig's organ morphogenesis
GO:0001748 P insect visual primordium development
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007224 P smoothened signaling pathway
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007420 P brain development
GO:0007422 P peripheral nervous system development
GO:0007423 P sensory organ development
GO:0007438 P oenocyte development
GO:0007455 P eye-antennal disc morphogenesis
GO:0007460 P R8 cell fate commitment
GO:0007605 P sensory perception of sound
GO:0008038 P neuron recognition
GO:0016330 P second mitotic wave involved in compound eye morphogenesis
GO:0016360 P sensory organ precursor cell fate determination
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0045165 P cell fate commitment
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0045464 P R8 cell fate specification
GO:0045465 P R8 cell differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0048666 P neuron development
GO:0048800 P antennal morphogenesis
GO:0048801 P antennal joint morphogenesis
GO:0048813 P dendrite morphogenesis
RNA-seq EntryA_BomoEE_comp31347_c0_seq1
Sequence
(Amino Acid)
MTAETYGHRLVYSEKDIFSNDVMLEYATEDCYLTWPRSPDSGRSSLEPTPSIDGSISHDS
THIAYRGLSRDMVLEDSAEDNDLLEGSGKRRGRATSAAVLRRRRLAANARERRRMQNLNK
AFDRLRGHLPSLGADRQLSKYETLQMAQTYIAALYELLQ
*(52 a.a.)

- SilkBase 1999-2023 -