SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE14605_5prime_partial:A_BomoEE_comp67852_c0_seq2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
PREDICTED:_transient_receptor_potential-gamma_protein_[Bombyx_mori]
Ontology
GO:0005216 F ion channel activity
GO:0005261 F cation channel activity
GO:0005262 F calcium channel activity
GO:0005515 F protein binding
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006816 P calcium ion transport
GO:0006828 P manganese ion transport
GO:0007601 P visual perception
GO:0007628 P adult walking behavior
GO:0009416 P response to light stimulus
GO:0015279 F store-operated calcium channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016028 C rhabdomere
GO:0022833 F mechanosensitive ion channel activity
GO:0034703 C cation channel complex
GO:0043025 C neuronal cell body
GO:0050884 P neuromuscular process controlling posture
GO:0050896 P response to stimulus
GO:0050908 P detection of light stimulus involved in visual perception
GO:0051480 P regulation of cytosolic calcium ion concentration
GO:0055085 P transmembrane transport
GO:0070588 P calcium ion transmembrane transport
GO:1990635 C proximal dendrite
RNA-seq EntryA_BomoEE_comp67852_c0_seq2
Sequence
(Amino Acid)
REHMRTIRRKVKQANERDFRYQAIMRNLVRRYVTVQQRRAESGGVTEDDVNEIKQDVSAF
RCELVEILRNSGMNTSTANAGAPGTTRSTVLDGSLDSFQ
*(32 a.a.)

- SilkBase 1999-2023 -