SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE14277_complete:A_BomoEE_comp67706_c0_seq3
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		PREDICTED:_apoptotic_chromatin_condensation_inducer_in_the_nucleus-like_[Papilio_polytes]
Ontology
GO:0001618 F virus receptor activity
GO:0001662 P behavioral fear response
GO:0001666 P response to hypoxia
GO:0002020 F protease binding
GO:0004177 F aminopeptidase activity
GO:0004252 F serine-type endopeptidase activity
GO:0005102 F signaling receptor binding
GO:0005576 C extracellular region
GO:0005765 C lysosomal membrane
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006508 P proteolysis
GO:0007155 P cell adhesion
GO:0008233 F peptidase activity
GO:0008236 F serine-type peptidase activity
GO:0008239 F dipeptidyl-peptidase activity
GO:0008284 P positive regulation of cell population proliferation
GO:0009986 C cell surface
GO:0010716 P negative regulation of extracellular matrix disassembly
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0016787 F hydrolase activity
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030139 C endocytic vesicle
GO:0031258 C lamellipodium membrane
GO:0031295 P T cell costimulation
GO:0033632 P regulation of cell-cell adhesion mediated by integrin
GO:0035641 P locomotory exploration behavior
GO:0036343 P psychomotor behavior
GO:0042110 P T cell activation
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0043542 P endothelial cell migration
GO:0045121 C membrane raft
GO:0046581 C intercellular canaliculus
GO:0046718 P viral entry into host cell
GO:0070062 C extracellular exosome
GO:0071438 C obsolete invadopodium membrane
RNA-seq EntryA_BomoEE_comp67706_c0_seq3
Sequence
(Amino Acid)
MYTGQATWFSRDGSYLAFATFNDTEVESYSYYYFVDKSNPDDLYPELVDLKYPKVGRTNP
TAVLRVVNLRALVENNNFNFITVEPPEEVTADHILGGVVWPTDNEIAVHWLNRRQNKTVL
RICNVVTWVCENEHREQPNGWVPIALPRFSSGGDFYVSTRWSFPQADGNIWQHLYVSMRV
AGQIISSSITPGAFTVNNFVGMDEQNLA
*(68 a.a.)

- SilkBase 1999-2023 -