SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE13857_complete:A_BomoEE_comp67349_c0_seq2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		ionotropic_GABA_receptor_subunit_[Bombyx_mori]
Ontology
GO:0001662 P behavioral fear response
GO:0002230 P positive regulation of defense response to virus by host
GO:0004872 F signaling receptor activity
GO:0004890 F GABA-A receptor activity
GO:0005215 F transporter activity
GO:0005216 F ion channel activity
GO:0005230 F extracellular ligand-gated ion channel activity
GO:0005254 F chloride channel activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006821 P chloride transport
GO:0007165 P signal transduction
GO:0007214 P gamma-aminobutyric acid signaling pathway
GO:0007268 P chemical synaptic transmission
GO:0007420 P brain development
GO:0007605 P sensory perception of sound
GO:0008306 P associative learning
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0032809 C neuronal cell body membrane
GO:0034220 P ion transmembrane transport
GO:0034707 C chloride channel complex
GO:0043235 C receptor complex
GO:0043523 P regulation of neuron apoptotic process
GO:0043524 P negative regulation of neuron apoptotic process
GO:0044297 C cell body
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0048666 P neuron development
GO:0050811 F GABA receptor binding
GO:0060119 P inner ear receptor cell development
GO:0060384 P innervation
GO:0090102 P cochlea development
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:0098792 P xenophagy
GO:1902476 P chloride transmembrane transport
GO:1902711 C GABA-A receptor complex
RNA-seq EntryA_BomoEE_comp67349_c0_seq2
Sequence
(Amino Acid)
MSFFYCIATLLEFAGVHYFTKVGSGEIVIDDSEWEELIEEVGGDAVAARELAVRRRSSAR
SATNNLSMPSQSSNPTTSDNLETEQPVAVRLTMERTTQTETRVPRWRQLLYCLAGDDRYR
RQRQREAGSRGHINSVSHIDRAARVLFPASFALLNLFYWMIYAFSSDDFAWSDNPINTLS
H
*(59 a.a.)

- SilkBase 1999-2023 -