SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE13766_5prime_partial:A_BomoEE_comp67287_c0_seq1
Scaffold_idBomo_Scaf121
NCBI non-redundant
(nr)
PREDICTED:_nuclear_pore_complex_protein_Nup98-Nup96_isoform_X1_[Bombyx_mori]
Ontology
GO:0000059 P obsolete protein import into nucleus, docking
GO:0000776 C kinetochore
GO:0000973 P posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0003723 F RNA binding
GO:0005215 F transporter activity
GO:0005487 F structural constituent of nuclear pore
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005643 C nuclear pore
GO:0005654 C nucleoplasm
GO:0005829 C cytosol
GO:0006260 P DNA replication
GO:0006405 P RNA export from nucleus
GO:0006406 P mRNA export from nucleus
GO:0006409 P tRNA export from nucleus
GO:0006810 P transport
GO:0006913 P nucleocytoplasmic transport
GO:0006999 P nuclear pore organization
GO:0007062 P sister chromatid cohesion
GO:0007077 P mitotic nuclear membrane disassembly
GO:0008139 F nuclear localization sequence binding
GO:0010827 P regulation of glucose transmembrane transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016925 P protein sumoylation
GO:0017056 F structural constituent of nuclear pore
GO:0019083 P viral transcription
GO:0031047 P gene silencing by RNA
GO:0031080 C nuclear pore outer ring
GO:0031965 C nuclear membrane
GO:0034398 P telomere tethering at nuclear periphery
GO:0034399 C nuclear periphery
GO:0042277 F peptide binding
GO:0042405 C nuclear inclusion body
GO:0044614 C nuclear pore cytoplasmic filaments
GO:0044615 C nuclear pore nuclear basket
GO:0051028 P mRNA transport
GO:0051292 P nuclear pore complex assembly
GO:0075733 P intracellular transport of virus
GO:1900034 P regulation of cellular response to heat
RNA-seq EntryA_BomoEE_comp67287_c0_seq1
Sequence
(Amino Acid)
GAAPPALAGAGWLRALHATARYICPQIPSLEKIIRTYEGFFSKDEQVDLTSLGDDVDMRP
PLPDYNEDYCYITSKNGNTKAVLDLRYELIRARAFNQRPKLKPAAYTPDPNDFTLCFLLG
AWFGSPSVESVVSVAEQLEAGGAWQLATAVLAYHPHGAARSSLVRSMISRHAPSSGSAPG
LQLLERIGVPEKWIHLARAHRAKYEHQPALEVEHLLAARQWSAAHRVLLDELLPDAVLND
DLQTVSRLLKTLEEAAERHEVADWESGGLALSHYIHVCDEIMAIQNEGDQWGRLEALRPR
LAAACRALPPPQHMSPRVAAARAQMGGRLLRLTLSANLSADKLASLVAALKLPPDCSACA
SHKITTELAERRLEGNYTALLAP
*(127 a.a.)

- SilkBase 1999-2023 -