SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE13746_complete:A_BomoEE_comp67257_c0_seq2
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		PREDICTED:_vang-like_protein_2_[Plutella_xylostella]
Ontology
GO:0001725 C stress fiber
GO:0001736 P establishment of planar polarity
GO:0001843 P neural tube closure
GO:0001942 P hair follicle development
GO:0001947 P heart looping
GO:0003149 P membranous septum morphogenesis
GO:0003150 P muscular septum morphogenesis
GO:0003402 P planar cell polarity pathway involved in axis elongation
GO:0003674 F molecular_function
GO:0005575 C cellular_component
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0007266 P Rho protein signal transduction
GO:0007275 P multicellular organism development
GO:0008150 P biological_process
GO:0009952 P anterior/posterior pattern specification
GO:0015012 P heparan sulfate proteoglycan biosynthetic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0016328 C lateral plasma membrane
GO:0022007 P convergent extension involved in neural plate elongation
GO:0030111 P regulation of Wnt signaling pathway
GO:0030134 C COPII-coated ER to Golgi transport vesicle
GO:0032835 P glomerulus development
GO:0032956 P regulation of actin cytoskeleton organization
GO:0035019 P somatic stem cell population maintenance
GO:0035058 P non-motile cilium assembly
GO:0035567 P non-canonical Wnt signaling pathway
GO:0035787 P cell migration involved in kidney development
GO:0036342 P post-anal tail morphogenesis
GO:0036514 P dopaminergic neuron axon guidance
GO:0036515 P serotonergic neuron axon guidance
GO:0042060 P wound healing
GO:0043507 P positive regulation of JUN kinase activity
GO:0045176 P apical protein localization
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0048103 P somatic stem cell division
GO:0048105 P establishment of body hair planar orientation
GO:0048546 P digestive tract morphogenesis
GO:0060028 P convergent extension involved in axis elongation
GO:0060029 P convergent extension involved in organogenesis
GO:0060071 P Wnt signaling pathway, planar cell polarity pathway
GO:0060119 P inner ear receptor cell development
GO:0060122 P inner ear receptor cell stereocilium organization
GO:0060187 C cell pole
GO:0060488 P orthogonal dichotomous subdivision of terminal units involved in lung branching morphogenesis
GO:0060489 P planar dichotomous subdivision of terminal units involved in lung branching morphogenesis
GO:0060490 P lateral sprouting involved in lung morphogenesis
GO:0060993 P kidney morphogenesis
GO:0061346 P planar cell polarity pathway involved in heart morphogenesis
GO:0071944 C cell periphery
GO:0090102 P cochlea development
GO:0090103 P cochlea morphogenesis
GO:0090175 P regulation of establishment of planar polarity
GO:0090177 P establishment of planar polarity involved in neural tube closure
GO:0090179 P planar cell polarity pathway involved in neural tube closure
RNA-seq EntryA_BomoEE_comp67257_c0_seq2
Sequence
(Amino Acid)
MLMLSFSNKLSNNFQCFNVNQQVSNPQVLAHLARCLSQDASPRAFLEPFLVEGPVLAADH
ETRPLQRWSLISDELLARPIAHNIDFQLRQGDVSLICSIKQLPKFSLSEEVVDPKSNRFV
LRLNSETSV
*(42 a.a.)

- SilkBase 1999-2023 -