SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE13737_complete:A_BomoEE_comp67253_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		PREDICTED:_RCC1_domain-containing_protein_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000079 P regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0000209 P protein polyubiquitination
GO:0002376 P immune system process
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0016874 F ligase activity
GO:0032020 P ISG15-protein conjugation
GO:0032480 P negative regulation of type I interferon production
GO:0042296 F ISG15 transferase activity
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0044822 F RNA binding
GO:0045087 P innate immune response
GO:0048471 C perinuclear region of cytoplasm
GO:0050688 P regulation of defense response to virus
GO:0051607 P defense response to virus
RNA-seq EntryA_BomoEE_comp67253_c0_seq1
Sequence
(Amino Acid)
MALSEFGDLYVWGLNDTGQLGIKESENDLKSYALPKLVDLYDDNEEVHLQIKDIACGSKH
SVLLLEDGSVWTTGANKYGQLACPQYPNSKNFNKVCVIKEACRLKCGPWTTVVVCN
*(38 a.a.)

- SilkBase 1999-2023 -