SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1351_complete:A_BomoEE_comp29484_c0_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		achaete-scute-like_protein_ASH2_[Bombyx_mori]
Ontology
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0002805 P regulation of antimicrobial peptide biosynthetic process
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007346 P regulation of mitotic cell cycle
GO:0007399 P nervous system development
GO:0007400 P neuroblast fate determination
GO:0007417 P central nervous system development
GO:0007419 P ventral cord development
GO:0007422 P peripheral nervous system development
GO:0007423 P sensory organ development
GO:0008407 P chaeta morphogenesis
GO:0010906 P regulation of glucose metabolic process
GO:0030154 P cell differentiation
GO:0043565 F sequence-specific DNA binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0048477 P oogenesis
GO:0050767 P regulation of neurogenesis
GO:0061331 P epithelial cell proliferation involved in Malpighian tubule morphogenesis
GO:0061382 P Malpighian tubule tip cell differentiation
GO:0090575 C RNA polymerase II transcription regulator complex
RNA-seq EntryA_BomoEE_comp29484_c0_seq1
Sequence
(Amino Acid)
MLQEIQLVQGQTNYVVVSSGYPSNTLNKSSLEKRNVAIAPAPEKNYVTHDTPPNLHYRKK
VHFRTNPYTGPQAASIARRNARERNRVKQVNDGFNALRRHLPASVVAALSGGARRGSSGK
KLSKVDTLRMVVEYIRYLQQLLDESDAALGITRDQENRENIPSNNSVQPMTSIDMDDGFF
YGSGSPCSEKADSPAPSECSSGVSSAYSAVDRYEVTTQQQMGSMDEEELLDVISWWQQK
*(79 a.a.)

- SilkBase 1999-2023 -