SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE13502_complete:A_BomoEE_comp67042_c1_seq1
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
PREDICTED:_protein_Wnt-2-like_[Bombyx_mori]
Ontology
GO:0001701 P in utero embryonic development
GO:0003338 P metanephros morphogenesis
GO:0005102 F signaling receptor binding
GO:0005109 F frizzled binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005615 C extracellular space
GO:0005788 C endoplasmic reticulum lumen
GO:0005796 C Golgi lumen
GO:0005886 C plasma membrane
GO:0007275 P multicellular organism development
GO:0016055 P Wnt signaling pathway
GO:0016332 P establishment or maintenance of polarity of embryonic epithelium
GO:0021871 P forebrain regionalization
GO:0022009 P central nervous system vasculogenesis
GO:0030182 P neuron differentiation
GO:0030324 P lung development
GO:0030666 C endocytic vesicle membrane
GO:0032364 P oxygen homeostasis
GO:0042592 P homeostatic process
GO:0044237 P cellular metabolic process
GO:0045165 P cell fate commitment
GO:0045669 P positive regulation of osteoblast differentiation
GO:0048144 P fibroblast proliferation
GO:0048568 P embryonic organ development
GO:0050808 P synapse organization
GO:0060070 P canonical Wnt signaling pathway
GO:0060425 P lung morphogenesis
GO:0060428 P lung epithelium development
GO:0060482 P lobar bronchus development
GO:0060535 P trachea cartilage morphogenesis
GO:0060560 P developmental growth involved in morphogenesis
GO:0060669 P embryonic placenta morphogenesis
GO:0060710 P chorio-allantoic fusion
GO:0061180 P mammary gland epithelium development
GO:0070062 C extracellular exosome
GO:0070307 P lens fiber cell development
GO:0071300 P cellular response to retinoic acid
GO:0072053 P renal inner medulla development
GO:0072054 P renal outer medulla development
GO:0072060 P outer medullary collecting duct development
GO:0072061 P inner medullary collecting duct development
GO:0072089 P stem cell proliferation
GO:0072205 P metanephric collecting duct development
GO:0072207 P metanephric epithelium development
GO:0072236 P metanephric loop of Henle development
RNA-seq EntryA_BomoEE_comp67042_c1_seq1
Sequence
(Amino Acid)
MACARGELPGCGCTGNKRRTINTIEQFQWGGCGSSAYGARLARRFLDARELERDGRTLMN
LHNNRVGRKVVKDLVHRECKCHGVSGSCAMRTCWRALPQFRAAAATLRDKYKRAKLVMPH
PATNPQDINVRTHLVIKRQKHPGLGRQPRKSELVFLEQSPSYCEPDTAAGSFGTHGRICN
RTSRGEDGCETLCCGRGYSTTRSVEETKCRCQFHWCCNVTCSKCVTTVETHLCN
*(77 a.a.)

- SilkBase 1999-2023 -