SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE13375_complete:A_BomoEE_comp66918_c1_seq2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		PREDICTED:_Bardet-Biedl_syndrome_7_protein_homolog_[Bombyx_mori]
Ontology
GO:0001103 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001654 P eye development
GO:0001750 C photoreceptor outer segment
GO:0001947 P heart looping
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0005930 C axoneme
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006810 P transport
GO:0007224 P smoothened signaling pathway
GO:0007368 P determination of left/right symmetry
GO:0007420 P brain development
GO:0007507 P heart development
GO:0007601 P visual perception
GO:0008104 P protein localization
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0030030 P cell projection organization
GO:0032402 P melanosome transport
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0034464 C BBSome
GO:0035058 P non-motile cilium assembly
GO:0036064 C ciliary basal body
GO:0042384 P cilium assembly
GO:0042995 C cell projection
GO:0045444 P fat cell differentiation
GO:0046907 P intracellular transport
GO:0048546 P digestive tract morphogenesis
GO:0050896 P response to stimulus
GO:0051877 P pigment granule aggregation in cell center
GO:0060021 P roof of mouth development
GO:0060170 C ciliary membrane
GO:0060173 P limb development
GO:0060271 P cilium assembly
RNA-seq EntryA_BomoEE_comp66918_c1_seq2
Sequence
(Amino Acid)
MTFWLSDILPGDLPRPASNVAFLRVHSLLGTKLYCQYQRGSAVFKSNNISTVSSVRSIIS
NCSIDKRIRVEISCDIPDDCCLKSFKLIENIISIAYEKKNQVTLAKALDLLELDTKAINA
EKPVLCKEYYTVLKNSESEILQSNFDELIDIVVQWYLDWRSLSVNGNNTVDQSNKLCTLL
KDYKLDDVTKVLSELTEFNHTCE
*(67 a.a.)

- SilkBase 1999-2023 -