SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE13359_5prime_partial:A_BomoEE_comp66898_c0_seq4
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		PREDICTED:_PHD_finger_protein_12-like_[Plutella_xylostella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001106 F transcription corepressor activity
GO:0001222 F transcription corepressor binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008270 F zinc ion binding
GO:0016580 C Sin3 complex
GO:0017053 C transcription repressor complex
GO:0035091 F phosphatidylinositol binding
GO:0042393 F histone binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoEE_comp66898_c0_seq4
Sequence
(Amino Acid)
AGAGAAGGECFVCGASCRVAPLLRCDYCPLLYHQDCLEPPLTALPTGRWMCPNHVEQYID
WKLVNSISATERVALWDRFAGPVDQHAIKIDFLRRARNPNPRFR
*(34 a.a.)

- SilkBase 1999-2023 -