SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE13186_complete:A_BomoEE_comp66754_c0_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		PREDICTED:_Bloom_syndrome_protein_homolog_isoform_X1_[Bombyx_mori]
Ontology
GO:0000079 P regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0000166 F nucleotide binding
GO:0000228 C nuclear chromosome
GO:0000405 F bubble DNA binding
GO:0000724 P double-strand break repair via homologous recombination
GO:0000729 P DNA double-strand break processing
GO:0000731 P DNA synthesis involved in DNA repair
GO:0000732 P strand displacement
GO:0000733 P obsolete DNA strand renaturation
GO:0000781 C chromosome, telomeric region
GO:0000800 C lateral element
GO:0002039 F p53 binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003697 F single-stranded DNA binding
GO:0003824 F catalytic activity
GO:0004003 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0008026 F helicase activity
GO:0009378 F four-way junction helicase activity
GO:0010165 P response to X-ray
GO:0016363 C nuclear matrix
GO:0016605 C PML body
GO:0016787 F hydrolase activity
GO:0016818 F hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0016887 F ATP hydrolysis activity
GO:0016925 P protein sumoylation
GO:0031297 P replication fork processing
GO:0032508 P DNA duplex unwinding
GO:0036310 F ATP-dependent DNA/DNA annealing activity
GO:0043140 F 3'-5' DNA helicase activity
GO:0044237 P cellular metabolic process
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045910 P negative regulation of DNA recombination
GO:0048478 P replication fork protection
GO:0051259 P protein complex oligomerization
GO:0051782 P negative regulation of cell division
GO:0051880 F G-quadruplex DNA binding
GO:0071479 P cellular response to ionizing radiation
GO:0072711 P cellular response to hydroxyurea
GO:0072757 P cellular response to camptothecin
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomoEE_comp66754_c0_seq1
Sequence
(Amino Acid)
MLEIFRETFGLTKFRPNQLQAINAALLGHDCFVLMPTGGGKSLCYQLPAVLSPGVTIVIS
PLKSLIMDQVRKLQTLGVPAADLSGNTSLAETDEIYHKLSMKEPPIKLLYVTPEKIVGSD
RFQSVLDSLDARGKFAR
*(45 a.a.)

- SilkBase 1999-2023 -