SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE12691_5prime_partial:A_BomoEE_comp66223_c0_seq1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC106116007_isoform_X2_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0000723 P telomere maintenance
GO:0000784 C chromosome, telomeric region
GO:0001756 P somitogenesis
GO:0001933 P negative regulation of protein phosphorylation
GO:0002326 P B cell lineage commitment
GO:0002328 P pro-B cell differentiation
GO:0002360 P T cell lineage commitment
GO:0002377 P immunoglobulin production
GO:0002638 P negative regulation of immunoglobulin production
GO:0002684 P positive regulation of immune system process
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004677 F DNA-dependent protein kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005730 C nucleolus
GO:0005829 C cytosol
GO:0005958 C DNA-dependent protein kinase-DNA ligase 4 complex
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006310 P DNA recombination
GO:0006464 P cellular protein modification process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007420 P brain development
GO:0007507 P heart development
GO:0008134 F transcription factor binding
GO:0008283 P cell population proliferation
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010212 P response to ionizing radiation
GO:0010332 P response to gamma radiation
GO:0014823 P response to activity
GO:0016020 C membrane
GO:0016233 P telomere capping
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0018105 P peptidyl-serine phosphorylation
GO:0019899 F enzyme binding
GO:0030098 P lymphocyte differentiation
GO:0031648 P protein destabilization
GO:0032481 P positive regulation of type I interferon production
GO:0032869 P cellular response to insulin stimulus
GO:0033077 P T cell differentiation in thymus
GO:0033151 P V(D)J recombination
GO:0033152 P immunoglobulin V(D)J recombination
GO:0033153 P T cell receptor V(D)J recombination
GO:0035234 P ectopic germ cell programmed cell death
GO:0042752 P regulation of circadian rhythm
GO:0043065 P positive regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0044822 F RNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048146 P positive regulation of fibroblast proliferation
GO:0048511 P rhythmic process
GO:0048536 P spleen development
GO:0048538 P thymus development
GO:0048639 P positive regulation of developmental growth
GO:0048660 P regulation of smooth muscle cell proliferation
GO:0070419 C nonhomologous end joining complex
GO:0072431 P mitotic G1 DNA damage checkpoint signaling
GO:0097681 P double-strand break repair via alternative nonhomologous end joining
GO:2000773 P negative regulation of cellular senescence
GO:2001229 P negative regulation of response to gamma radiation
RNA-seq EntryA_BomoEE_comp66223_c0_seq1
Sequence
(Amino Acid)
AAELRWAGGAARAALWGHVSACVERARGQILNDADVPKFLLLNLKMKREMATGASGKLDE
LLTKAERHAPVVLEHASDEEFYGINEMLLRIRSDLGTMNQASMDAVLQTVDRRLQRGGAV
SPDSRRALDSMYEMYFVYYNHLWTESDDERRKEIFLWMLDVMVQAARAHTVRLGALVAAA
CDRLPDSVPDNVLEKLELAFPALQDWHRTELVSRLRRSASALRNYKHLSSQLEFEGRAET
FKRRLRLVCDPEYTLVMYCGDLLEAATRADPSQWKMIFDRVKSDMYDGGGGPEYLLLENY
KSALFDIEDYENSDTETKIRTLRRVQEGAGRGGYRPTLRLSQLCGGLGAEPAADDCVSAV
LQLPPGVTVVEFYEEVAVMPSIRRPCMVRALLSSGITRRWLVKRDQLLHDRAASRLLPAA
AIPGNPPSLYNVTLLSEDCGLIEYLEGHHSIRSLAAKSCDLDNLGVSRPLDADLLAEPPS
RLALTHERFCGKVPATVLRSAFQELCCTSEDFIRRKKRFQDSLATITIFNWIFDVGDRHM
ENFLVEASTGALCCIDWGSTMQRRQLSEPPPARLTRNMLAMCDPIALEARLQTALTQLRD
SRETFLATARLLYARAPACQPQLSHVKAILEGKVTSADIRVEANPDPDLDRLRALLVQVF
PGRPATDTYSVKDQVQVLLRHCTDPRVLGATRAGWEPWL
*(232 a.a.)

- SilkBase 1999-2023 -