SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE12476_complete:A_BomoEE_comp65977_c0_seq12
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
PREDICTED:_DNA_repair_protein_RAD51_homolog_4_isoform_X2_[Bombyx_mori]
Ontology
GO:0000150 F DNA strand exchange activity
GO:0000166 F nucleotide binding
GO:0000400 F four-way junction DNA binding
GO:0000707 P meiotic DNA recombinase assembly
GO:0000722 P telomere maintenance via recombination
GO:0000723 P telomere maintenance
GO:0000724 P double-strand break repair via homologous recombination
GO:0000781 C chromosome, telomeric region
GO:0000784 C chromosome, telomeric region
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003697 F single-stranded DNA binding
GO:0004520 F endodeoxyribonuclease activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005657 C replication fork
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006310 P DNA recombination
GO:0006312 P mitotic recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007131 P reciprocal meiotic recombination
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0010212 P response to ionizing radiation
GO:0033063 C Rad51B-Rad51C-Rad51D-XRCC2 complex
GO:0036297 P interstrand cross-link repair
GO:0042148 P strand invasion
GO:0043015 F gamma-tubulin binding
GO:0051276 P chromosome organization
GO:0051726 P regulation of cell cycle
RNA-seq EntryA_BomoEE_comp65977_c0_seq12
Sequence
(Amino Acid)
MLNRGIPAKTITELCGIAGSGKTQLALQIAINCAKETHKTVLYIDTKGDFSALRIQKILE
KCQYSFKEVAAIMSRIHISYIWTMEELVNLFKNLKNGELVIDNLVLLVIDSLPSLMFQYL
GEDNKLGLSLLNSFVNYSRFICKQLNIGIICINMQTRWVDQDLTDVEG
*(55 a.a.)

- SilkBase 1999-2023 -