SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE12397_5prime_partial:A_BomoEE_comp65934_c0_seq2
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		PREDICTED:_neogenin_[Bombyx_mori]
Ontology
GO:0001764 P neuron migration
GO:0004888 F transmembrane signaling receptor activity
GO:0005042 F netrin receptor activity
GO:0005515 F protein binding
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006915 P apoptotic process
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0010977 P negative regulation of neuron projection development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0021965 P spinal cord ventral commissure morphogenesis
GO:0030424 C axon
GO:0033563 P dorsal/ventral axon guidance
GO:0033564 P anterior/posterior axon guidance
GO:0038007 P netrin-activated signaling pathway
GO:0048671 P negative regulation of collateral sprouting
GO:0097192 P extrinsic apoptotic signaling pathway in absence of ligand
GO:1901214 P regulation of neuron death
GO:2000171 P negative regulation of dendrite development
RNA-seq EntryA_BomoEE_comp65934_c0_seq2
Sequence
(Amino Acid)
LALAAALALSLCCRRSQPPLSPDTSTYQKSSASAGIKPPDLWIHHDQMELKHMDKGIHAS
ASKISSDSVEGSLSLPRSAPRPPAPPPVEYEPARGLPPPSSLDRRHYVPTYVGKLTLYCK
SATVLNLFSVPVCKIVHSFPCLVSRHLSFLTLSNFTLSFLDNNSLH
*(54 a.a.)

- SilkBase 1999-2023 -