SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE12385_complete:A_BomoEE_comp65923_c0_seq1
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)		PREDICTED:_protein_Wnt-4-like_isoform_X2_[Bombyx_mori]
Ontology
GO:0001656 P metanephros development
GO:0001658 P branching involved in ureteric bud morphogenesis
GO:0001822 P kidney development
GO:0001823 P mesonephros development
GO:0001837 P epithelial to mesenchymal transition
GO:0001838 P embryonic epithelial tube formation
GO:0001889 P liver development
GO:0003714 F transcription corepressor activity
GO:0005102 F signaling receptor binding
GO:0005109 F frizzled binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005788 C endoplasmic reticulum lumen
GO:0006702 P androgen biosynthetic process
GO:0007165 P signal transduction
GO:0007267 P cell-cell signaling
GO:0007275 P multicellular organism development
GO:0007276 P gamete generation
GO:0007548 P sex differentiation
GO:0008584 P male gonad development
GO:0008585 P female gonad development
GO:0009267 P cellular response to starvation
GO:0009986 C cell surface
GO:0010629 P negative regulation of gene expression
GO:0010894 P negative regulation of steroid biosynthetic process
GO:0016055 P Wnt signaling pathway
GO:0022407 P regulation of cell-cell adhesion
GO:0030154 P cell differentiation
GO:0030182 P neuron differentiation
GO:0030237 P female sex determination
GO:0030325 P adrenal gland development
GO:0030336 P negative regulation of cell migration
GO:0030501 P positive regulation of bone mineralization
GO:0032349 P positive regulation of aldosterone biosynthetic process
GO:0032967 P positive regulation of collagen biosynthetic process
GO:0033077 P T cell differentiation in thymus
GO:0033080 P immature T cell proliferation in thymus
GO:0035239 P tube morphogenesis
GO:0035567 P non-canonical Wnt signaling pathway
GO:0038030 P non-canonical Wnt signaling pathway via MAPK cascade
GO:0040037 P negative regulation of fibroblast growth factor receptor signaling pathway
GO:0042445 P hormone metabolic process
GO:0043547 P positive regulation of GTPase activity
GO:0045165 P cell fate commitment
GO:0045596 P negative regulation of cell differentiation
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045836 P positive regulation of meiotic nuclear division
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048599 P oocyte development
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0048856 P anatomical structure development
GO:0051145 P smooth muscle cell differentiation
GO:0051496 P positive regulation of stress fiber assembly
GO:0051894 P positive regulation of focal adhesion assembly
GO:0060070 P canonical Wnt signaling pathway
GO:0060126 P somatotropin secreting cell differentiation
GO:0060129 P thyroid-stimulating hormone-secreting cell differentiation
GO:0060231 P mesenchymal to epithelial transition
GO:0060748 P tertiary branching involved in mammary gland duct morphogenesis
GO:0060993 P kidney morphogenesis
GO:0061045 P negative regulation of wound healing
GO:0061180 P mammary gland epithelium development
GO:0061184 P positive regulation of dermatome development
GO:0061205 P paramesonephric duct development
GO:0061369 P negative regulation of testicular blood vessel morphogenesis
GO:0071560 P cellular response to transforming growth factor beta stimulus
GO:0072006 P nephron development
GO:0072033 P renal vesicle formation
GO:0072034 P renal vesicle induction
GO:0072162 P metanephric mesenchymal cell differentiation
GO:0072164 P mesonephric tubule development
GO:0072174 P metanephric tubule formation
GO:0072210 P metanephric nephron development
GO:0072273 P metanephric nephron morphogenesis
GO:0090002 P protein localization to plasma membrane
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:2000019 P negative regulation of male gonad development
GO:2000066 P positive regulation of cortisol biosynthetic process
GO:2000225 P negative regulation of testosterone biosynthetic process
GO:2001234 P negative regulation of apoptotic signaling pathway
RNA-seq EntryA_BomoEE_comp65923_c0_seq1
Sequence
(Amino Acid)
MLLLWKLLWSLLMLAQAAMGNWWNLAVPLSDQSGNTSLEAVTTLRKESCHRLEFLVERQK
KLCMLSDKMIQVLQTGAMQAVEECQHQFRNSRWNCSIVENSTDIFGGVLKYKSRESAFVH
ALSSAALAHAVARACSRGELNDCSCDSKVRKRTPRHWQWGGCSEDIRYGEIYSRDFLDSR
EDRTTDEGLVNLHNNDAGRRAVRSRMQRVCKCHGMSGSCSVRVCWRRLPQLHVVGDALST
RYEGASHVKIVERKKGKNLRKIRPIHADMKKPNKTDLVYLEDSPDYCEPNEELGILGTRG
RTCNRTSAGIDGCRLLCCGRGYQTRVQDYEVKCKCRFVWCCRVQCEICRFKRDHHVCN
*(118 a.a.)

- SilkBase 1999-2023 -