SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE12038_3prime_partial:A_BomoEE_comp65635_c0_seq2
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		PREDICTED:_glutamate_receptor_ionotropic,_kainate_2-like,_partial_[Papilio_polytes]
Ontology
GO:0004872 F signaling receptor activity
GO:0004970 F ionotropic glutamate receptor activity
GO:0005216 F ion channel activity
GO:0005234 F extracellularly glutamate-gated ion channel activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0008328 C ionotropic glutamate receptor complex
GO:0014054 P positive regulation of gamma-aminobutyric acid secretion
GO:0014069 C postsynaptic density
GO:0015277 F kainate selective glutamate receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0030534 P adult behavior
GO:0032230 P positive regulation of synaptic transmission, GABAergic
GO:0032983 C kainate selective glutamate receptor complex
GO:0034220 P ion transmembrane transport
GO:0035235 P ionotropic glutamate receptor signaling pathway
GO:0035249 P synaptic transmission, glutamatergic
GO:0042391 P regulation of membrane potential
GO:0042734 C presynaptic membrane
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0048169 P regulation of long-term neuronal synaptic plasticity
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0048266 P behavioral response to pain
GO:0051899 P membrane depolarization
GO:0051967 P negative regulation of synaptic transmission, glutamatergic
GO:0060079 P excitatory postsynaptic potential
GO:0060080 P inhibitory postsynaptic potential
GO:0097481 C postsynaptic density
RNA-seq EntryA_BomoEE_comp65635_c0_seq2
Sequence
(Amino Acid)
MRPEWRWIVVVLNVVGALSPVIKIGALFTEDERGGSEELAFKYSVYRINKERSVLANSTL
VYDIQYAPAKDTFKTYKRACSQVKSGAVALFSSGGDLLGSTLDAICRSLHAPHMLVAPQT
RPTLNNESFTINLYPPRGLLNEAFGDLIGYLNWTRMGVLYEDFGYGDLSILDIAKDGRDM
YAVRCVDPKDYRKSLIQLKAQRIKNVIVDTDPARFRQLARAILQLQMNSEEYHYIFTSFD
MELFDLEDFYYNRVNMSGWRLVDRDSDKVKDALQVM
(91 a.a.)

- SilkBase 1999-2023 -