SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1188_internal:A_BomoEE_comp26396_c0_seq2
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		PREDICTED:_DNA_topoisomerase_2-binding_protein_1_[Bombyx_mori]
Ontology
GO:0000794 C condensed nuclear chromosome
GO:0000922 C spindle pole
GO:0001673 C male germ cell nucleus
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006259 P DNA metabolic process
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0008022 F protein C-terminus binding
GO:0010212 P response to ionizing radiation
GO:0015629 C actin cytoskeleton
GO:0016605 C PML body
GO:0042802 F identical protein binding
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomoEE_comp26396_c0_seq2
Sequence
(Amino Acid)
APALPAAPTRKFMLSSNVDNREEIMSMIEQLGGEVCDGAEPAPDATHLLCAAPGRSEKML
GSIAAGRWVLHPRYVPCSRDAGAFLPEEEFEWGNPLASR
(32 a.a.)

- SilkBase 1999-2023 -