SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE11889_5prime_partial:A_BomoEE_comp65493_c0_seq1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
similar_to_CG30291,_partial_[Papilio_xuthus]
Ontology
GO:0000079 P regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0001933 P negative regulation of protein phosphorylation
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007346 P regulation of mitotic cell cycle
GO:0007420 P brain development
GO:0008283 P cell population proliferation
GO:0010921 P regulation of phosphatase activity
GO:0012505 C endomembrane system
GO:0030262 P apoptotic nuclear changes
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0031398 P positive regulation of protein ubiquitination
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032403 F protein-containing complex binding
GO:0043407 P negative regulation of MAP kinase activity
GO:0044387 P negative regulation of protein kinase activity by regulation of protein phosphorylation
GO:0044389 F ubiquitin-like protein ligase binding
GO:0044818 P mitotic G2/M transition checkpoint
GO:0045664 P regulation of neuron differentiation
GO:0071901 P negative regulation of protein serine/threonine kinase activity
GO:1900182 P positive regulation of protein localization to nucleus
GO:1901798 P positive regulation of signal transduction by p53 class mediator
GO:1903363 P negative regulation of cellular protein catabolic process
GO:2000060 P positive regulation of ubiquitin-dependent protein catabolic process
RNA-seq EntryA_BomoEE_comp65493_c0_seq1
Sequence
(Amino Acid)
GAVQRAAAALAAPDLAHLHNVKHSPRYVDVLTAQLKQKLVLCEKLSKLAARAAEQRTAAN
VRAAELRPVLSKIIERTKQLQAQIESDISKKYKGRPVNIIGGVKFL
*(34 a.a.)

- SilkBase 1999-2023 -