EntryView

ORF from Assembled RNA_seq Entry

Name

O_BomoEE11889_5prime_partial:A_BomoEE_comp65493_c0_seq1

Scaffold_id

NCBI non-redundant
(nr)

similar_to_CG30291,_partial_[Papilio_xuthus]

Ontology

GO:0000079	P	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0001933	P	negative regulation of protein phosphorylation
GO:0005575	C	cellular_component
GO:0005634	C	nucleus
GO:0005737	C	cytoplasm
GO:0005813	C	centrosome
GO:0005815	C	microtubule organizing center
GO:0005856	C	cytoskeleton
GO:0005874	C	microtubule
GO:0007095	P	mitotic G2 DNA damage checkpoint signaling
GO:0007346	P	regulation of mitotic cell cycle
GO:0007420	P	brain development
GO:0008283	P	cell population proliferation
GO:0010921	P	regulation of phosphatase activity
GO:0012505	C	endomembrane system
GO:0030262	P	apoptotic nuclear changes
GO:0030968	P	endoplasmic reticulum unfolded protein response
GO:0031398	P	positive regulation of protein ubiquitination
GO:0032088	P	negative regulation of NF-kappaB transcription factor activity
GO:0032403	F	protein-containing complex binding
GO:0043407	P	negative regulation of MAP kinase activity
GO:0044387	P	negative regulation of protein kinase activity by regulation of protein phosphorylation
GO:0044389	F	ubiquitin-like protein ligase binding
GO:0044818	P	mitotic G2/M transition checkpoint
GO:0045664	P	regulation of neuron differentiation
GO:0071901	P	negative regulation of protein serine/threonine kinase activity
GO:1900182	P	positive regulation of protein localization to nucleus
GO:1901798	P	positive regulation of signal transduction by p53 class mediator
GO:1903363	P	negative regulation of cellular protein catabolic process
GO:2000060	P	positive regulation of ubiquitin-dependent protein catabolic process

RNA-seq Entry

Sequence
(Amino Acid)

GAVQRAAAALAAPDLAHLHNVKHSPRYVDVLTAQLKQKLVLCEKLSKLAARAAEQRTAAN
VRAAELRPVLSKIIERTKQLQAQIESDISKKYKGRPVNIIGGVKFL
*(34 a.a.)

- SilkBase 1999-2023 -