SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE11699_complete:A_BomoEE_comp65327_c0_seq5
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
Uncharacterized_protein_OBRU01_16214_[Operophtera_brumata]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0006726 P eye pigment biosynthetic process
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007218 P neuropeptide signaling pathway
GO:0007601 P visual perception
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0032400 P melanosome localization
GO:0032402 P melanosome transport
GO:0032438 P melanosome organization
GO:0033162 C melanosome membrane
GO:0035240 F dopamine binding
GO:0035584 P calcium-mediated signaling using intracellular calcium source
GO:0035643 F L-DOPA receptor activity
GO:0042470 C melanosome
GO:0048015 P phosphatidylinositol-mediated signaling
GO:0050848 P regulation of calcium-mediated signaling
GO:0072544 F L-DOPA binding
GO:0072545 F tyrosine binding
GO:1902908 P regulation of melanosome transport
GO:1903056 P regulation of melanosome organization
RNA-seq EntryA_BomoEE_comp65327_c0_seq5
Sequence
(Amino Acid)
MCHNLPSVTSALYKILPNYFASYVPIAIVMIANPIIYMFSSKNVETAISLPLAQFTSKER
RVVDALRLKFFFINIVFYICWLPNLLNGILLWTMWFSVPINAVVVIWYIMALLNPMQALL
NALVYRRWNLSKWRYSQRNSKMFRRDVMYYDEQSPLLGSEPPRHHMSSAPPSINNYATL
*(59 a.a.)

- SilkBase 1999-2023 -