SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1168_internal:A_BomoEE_comp25912_c1_seq1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		candidate_olfactory_receptor_[Bombyx_mori]
Ontology
GO:0001582 P detection of chemical stimulus involved in sensory perception of sweet taste
GO:0004871 F obsolete signal transducer activity
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0008343 P adult feeding behavior
GO:0008527 F taste receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0032098 P regulation of appetite
GO:0033041 F sweet taste receptor activity
GO:0050909 P sensory perception of taste
GO:0050912 P detection of chemical stimulus involved in sensory perception of taste
GO:0050916 P sensory perception of sweet taste
GO:0060259 P regulation of feeding behavior
GO:0071332 P cellular response to fructose stimulus
RNA-seq EntryA_BomoEE_comp25912_c1_seq1
Sequence
(Amino Acid)
PYYLIISFVTESPHTGFEKVLNPILQTVWCLYHTFGLVMIIEPCHRTHEEMETTRELVSR
VMCSADPRDPISVELEMFFRQLVLNKASYAPLKVCTLTRSLVATIL
(34 a.a.)

- SilkBase 1999-2023 -