SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1162_internal:A_BomoEE_comp25846_c0_seq1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		PREDICTED:_glutamate_receptor_1-like_[Bombyx_mori]
Ontology
GO:0004872 F signaling receptor activity
GO:0004970 F ionotropic glutamate receptor activity
GO:0004971 F AMPA glutamate receptor activity
GO:0005216 F ion channel activity
GO:0005231 F excitatory extracellular ligand-gated ion channel activity
GO:0005234 F extracellularly glutamate-gated ion channel activity
GO:0005515 F protein binding
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0007165 P signal transduction
GO:0007268 P chemical synaptic transmission
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030666 C endocytic vesicle membrane
GO:0032281 C AMPA glutamate receptor complex
GO:0034220 P ion transmembrane transport
GO:0035235 P ionotropic glutamate receptor signaling pathway
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
RNA-seq EntryA_BomoEE_comp25846_c0_seq1
Sequence
(Amino Acid)
AVSVVLFLVSRFSPHEWRLISFTDSQTSDHSEVATTKTTAVNEFTFWNSMWFSLGSFMQQ
GSDITPRSISGRIVGSVWWFFALIVISSYTANLASYLTLTRISEPSQSYNKLATCPEDTA
GNLGNSMF
(41 a.a.)

- SilkBase 1999-2023 -