| Name | O_BomoEE11624_complete:A_BomoEE_comp65253_c0_seq5 |
| Scaffold_id | Bomo_Chr15 |
NCBI non-redundant (nr) | cytochrome_P450_CYP332A1_[Bombyx_mori] |
| Ontology |
| GO:0004497 |
F |
monooxygenase activity |
| GO:0005506 |
F |
iron ion binding |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0005789 |
C |
endoplasmic reticulum membrane |
| GO:0009055 |
F |
electron transfer activity |
| GO:0016020 |
C |
membrane |
| GO:0016491 |
F |
oxidoreductase activity |
| GO:0016705 |
F |
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
| GO:0020037 |
F |
heme binding |
| GO:0031090 |
C |
organelle membrane |
| GO:0043231 |
C |
intracellular membrane-bounded organelle |
| GO:0046872 |
F |
metal ion binding |
| GO:0055114 |
P |
obsolete oxidation-reduction process |
|
| RNA-seq Entry | A_BomoEE_comp65253_c0_seq5 |
Sequence (Amino Acid) | MFTSLRLKTICELMNVNAKELVLKIQRDYIDNNEDVNLKELFSMYTSDTVGYTVFGLRVS
ALNDPSSPLWFITNHMVKWDFWRGFEFTAIFFVPALARFLR
*(33 a.a.) |