| Name | O_BomoEE11565_complete:A_BomoEE_comp65177_c0_seq2 |
| Scaffold_id | Bomo_Chr24 |
NCBI non-redundant
(nr) | PREDICTED:_LOW_QUALITY_PROTEIN:_E3_ubiquitin-protein_ligase_RFWD2-like_[Plutella_xylostella] |
| Ontology |
| GO:0000139 |
C |
Golgi membrane |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0005813 |
C |
centrosome |
| GO:0005925 |
C |
focal adhesion |
| GO:0008270 |
F |
zinc ion binding |
| GO:0010212 |
P |
response to ionizing radiation |
| GO:0016567 |
P |
protein ubiquitination |
| GO:0016607 |
C |
nuclear speck |
| GO:0016874 |
F |
ligase activity |
| GO:0032436 |
P |
positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| GO:0046872 |
F |
metal ion binding |
| GO:0061630 |
F |
ubiquitin protein ligase activity |
|
| RNA-seq Entry | A_BomoEE_comp65177_c0_seq2 |
Sequence
(Amino Acid) | MQCSHKISCVSWNKYHKHVLASSDYEGTVSVWDAGTAVRTRALQEHDKRAWSVHFNRADV
RLLASGSDDARVKLWALNQEKSVATLEAKFNVCCVRFNPNSSCHLAFGSAGMCTAPQ
*(38 a.a.) |
