SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE11508_complete:A_BomoEE_comp65145_c0_seq3
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		L-isoaspartyl_protein_carboxyl_methyltransferase_[Bombyx_mori]
Ontology
GO:0004719 F protein-L-isoaspartate (D-aspartate) O-methyltransferase activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006464 P cellular protein modification process
GO:0006479 P protein methylation
GO:0007568 P aging
GO:0008168 F methyltransferase activity
GO:0008757 F S-adenosylmethionine-dependent methyltransferase activity
GO:0010667 P negative regulation of cardiac muscle cell apoptotic process
GO:0016323 C basolateral plasma membrane
GO:0016740 F transferase activity
GO:0031526 C brush border membrane
GO:0032259 P methylation
GO:0043005 C neuron projection
GO:0043204 C perikaryon
GO:0045471 P response to ethanol
GO:0046498 P S-adenosylhomocysteine metabolic process
GO:0046500 P S-adenosylmethionine metabolic process
GO:0071456 P cellular response to hypoxia
RNA-seq EntryA_BomoEE_comp65145_c0_seq3
Sequence
(Amino Acid)
MKNKYTWIKNICLAVIVIIPIIMAWRSHGANNVDLIRNLRTNGIIKSDTVANAMLAVDRK
NYCPSSPYQDSPQSIGFSATISAPHMLVMVVSVIHLKPLTVQFMSGLQHPHYHKL
*(37 a.a.)

- SilkBase 1999-2023 -