SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE11257_complete:A_BomoEE_comp64924_c0_seq2
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
PREDICTED:_NADPH_oxidase_4-like_[Bombyx_mori]
Ontology
GO:0000902 P cell morphogenesis
GO:0001666 P response to hypoxia
GO:0001725 C stress fiber
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006801 P superoxide metabolic process
GO:0007568 P aging
GO:0007569 P cell aging
GO:0008285 P negative regulation of cell population proliferation
GO:0010467 P gene expression
GO:0014911 P positive regulation of smooth muscle cell migration
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016174 F NAD(P)H oxidase H2O2-forming activity
GO:0016175 F superoxide-generating NAD(P)H oxidase activity
GO:0016324 C apical plasma membrane
GO:0016491 F oxidoreductase activity
GO:0030054 C cell junction
GO:0042554 P superoxide anion generation
GO:0043020 C NADPH oxidase complex
GO:0043065 P positive regulation of apoptotic process
GO:0043406 P positive regulation of MAP kinase activity
GO:0045453 P bone resorption
GO:0048471 C perinuclear region of cytoplasm
GO:0050664 F oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
GO:0050667 P homocysteine metabolic process
GO:0051496 P positive regulation of stress fiber assembly
GO:0051897 P positive regulation of protein kinase B signaling
GO:0055007 P cardiac muscle cell differentiation
GO:0055114 P obsolete oxidation-reduction process
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071320 P cellular response to cAMP
GO:0071333 P cellular response to glucose stimulus
GO:0071480 P cellular response to gamma radiation
GO:0071560 P cellular response to transforming growth factor beta stimulus
GO:0071944 C cell periphery
GO:0072341 F modified amino acid binding
GO:0072593 P reactive oxygen species metabolic process
GO:2000379 P positive regulation of reactive oxygen species metabolic process
GO:2000573 P positive regulation of DNA biosynthetic process
RNA-seq EntryA_BomoEE_comp64924_c0_seq2
Sequence
(Amino Acid)
MAGRVISLKLSCPDLEFKCRAGQYVLLQCLDSSLIEWHPFTVVKVPTENQRYFIVWIRVK
GDWTDALEKLLLYTRPNTLNILVDGPFSSPMEGVSWCEVAICVAAGVGITPFVPVLHHML
QNPRSRFPGRVHLIWIVRSENELAWLADLANKTILQLRTANRPDRLHLELYVTKDNVQTK
AHTVSIDEKGSLTHVVRDNVTDDEKTTLLTPNKRSPYTKAESRNSCDVIKEYPVLGCRVL
RGRPYWDRVFGFWVHFYPE
*(85 a.a.)

- SilkBase 1999-2023 -