SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE11158_complete:A_BomoEE_comp64817_c0_seq1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		PREDICTED:_angiotensin-converting_enzyme_[Bombyx_mori]
Ontology
GO:0001822 P kidney development
GO:0002446 P neutrophil mediated immunity
GO:0003081 P regulation of systemic arterial blood pressure by renin-angiotensin
GO:0003084 P positive regulation of systemic arterial blood pressure
GO:0003779 F actin binding
GO:0004175 F endopeptidase activity
GO:0004180 F carboxypeptidase activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0007283 P spermatogenesis
GO:0008144 F obsolete drug binding
GO:0008217 P regulation of blood pressure
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008238 F exopeptidase activity
GO:0008240 F tripeptidyl-peptidase activity
GO:0008241 F peptidyl-dipeptidase activity
GO:0008270 F zinc ion binding
GO:0009897 C external side of plasma membrane
GO:0010608 P posttranscriptional regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0031404 F chloride ion binding
GO:0031434 F mitogen-activated protein kinase kinase binding
GO:0031711 F bradykinin receptor binding
GO:0032091 P negative regulation of protein binding
GO:0032092 P positive regulation of protein binding
GO:0042447 P hormone catabolic process
GO:0043171 P peptide catabolic process
GO:0046872 F metal ion binding
GO:0050435 P amyloid-beta metabolic process
GO:0050482 P arachidonic acid secretion
GO:0051019 F mitogen-activated protein kinase binding
GO:0060047 P heart contraction
GO:0060177 P regulation of angiotensin metabolic process
GO:0061098 P positive regulation of protein tyrosine kinase activity
GO:0070062 C extracellular exosome
GO:0071838 P cell proliferation in bone marrow
GO:1900086 P positive regulation of peptidyl-tyrosine autophosphorylation
GO:1902033 P regulation of hematopoietic stem cell proliferation
GO:1903597 P negative regulation of gap junction assembly
GO:2000170 P positive regulation of peptidyl-cysteine S-nitrosylation
RNA-seq EntryA_BomoEE_comp64817_c0_seq1
Sequence
(Amino Acid)
MERGSSAPWTHILQEAIGESRLNGEAMRDYFRPLEDWLSSENLRTGEFLGWSYDGDYCKF
SIETAGLQVYGGFYNAAQRHYDVTTFIALFVTSALVTIAFRYR
*(33 a.a.)

- SilkBase 1999-2023 -