SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE11084_complete:A_BomoEE_comp64756_c0_seq1
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		PREDICTED:_peripheral-type_benzodiazepine_receptor_isoform_X1_[Bombyx_mori]
Ontology
GO:0005497 F androgen binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0006694 P steroid biosynthetic process
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006821 P chloride transport
GO:0006869 P lipid transport
GO:0007268 P chemical synaptic transmission
GO:0007568 P aging
GO:0008347 P glial cell migration
GO:0008503 F benzodiazepine receptor activity
GO:0010042 P response to manganese ion
GO:0010266 P response to vitamin B1
GO:0010823 P negative regulation of mitochondrion organization
GO:0010940 P positive regulation of necrotic cell death
GO:0014012 P peripheral nervous system axon regeneration
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030325 P adrenal gland development
GO:0031397 P negative regulation of protein ubiquitination
GO:0031965 C nuclear membrane
GO:0031966 C mitochondrial membrane
GO:0032570 P response to progesterone
GO:0032720 P negative regulation of tumor necrosis factor production
GO:0033574 P response to testosterone
GO:0042493 P response to xenobiotic stimulus
GO:0043065 P positive regulation of apoptotic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0044325 F transmembrane transporter binding
GO:0045019 P negative regulation of nitric oxide biosynthetic process
GO:0048265 P response to pain
GO:0048266 P behavioral response to pain
GO:0048678 P response to axon injury
GO:0050810 P regulation of steroid biosynthetic process
GO:0051901 P positive regulation of mitochondrial depolarization
GO:0051928 P positive regulation of calcium ion transport
GO:0060242 P contact inhibition
GO:0060252 P positive regulation of glial cell proliferation
GO:0060253 P negative regulation of glial cell proliferation
GO:0070062 C extracellular exosome
GO:0071222 P cellular response to lipopolysaccharide
GO:0071294 P cellular response to zinc ion
GO:0071476 P cellular hypotonic response
GO:0072655 P establishment of protein localization to mitochondrion
GO:0072656 P maintenance of protein location in mitochondrion
GO:0098794 C postsynapse
GO:0099565 P chemical synaptic transmission, postsynaptic
GO:1903147 P negative regulation of autophagy of mitochondrion
GO:1903579 P negative regulation of ATP metabolic process
GO:2000379 P positive regulation of reactive oxygen species metabolic process
RNA-seq EntryA_BomoEE_comp64756_c0_seq1
Sequence
(Amino Acid)
MANWPALGSIILPNVGGWANGLFFAGQIRKDNSEKSWYDELKKPSWTPPKWVFGPAWTVL
YSSMGYASYLIWEECDGFTEDAVLPLTLYGVQLLLNWSWTPIFFGLKDFKLAFIEISVLS
GAAVATTLSFGSVNKTAGLLLIPYLAWLGYASSLSYYIWKNNPKPVKGQ
*(55 a.a.)

- SilkBase 1999-2023 -