Name | O_BomoEE10938_internal:A_BomoEE_comp64627_c0_seq3 |
Scaffold_id | Bomo_Chr8 |
NCBI non-redundant (nr) | PREDICTED:_protein_deltex_[Bombyx_mori] |
Ontology |
GO:0005112 |
F |
Notch binding |
GO:0005737 |
C |
cytoplasm |
GO:0005829 |
C |
cytosol |
GO:0006897 |
P |
endocytosis |
GO:0007219 |
P |
Notch signaling pathway |
GO:0007220 |
P |
Notch receptor processing |
GO:0008270 |
F |
zinc ion binding |
GO:0008593 |
P |
regulation of Notch signaling pathway |
GO:0016055 |
P |
Wnt signaling pathway |
GO:0016348 |
P |
imaginal disc-derived leg joint morphogenesis |
GO:0016567 |
P |
protein ubiquitination |
GO:0016874 |
F |
ligase activity |
GO:0017124 |
F |
SH3 domain binding |
GO:0035220 |
P |
wing disc development |
GO:0045746 |
P |
negative regulation of Notch signaling pathway |
GO:0045747 |
P |
positive regulation of Notch signaling pathway |
GO:0046872 |
F |
metal ion binding |
GO:0061630 |
F |
ubiquitin protein ligase activity |
|
RNA-seq Entry | A_BomoEE_comp64627_c0_seq3 |
Sequence (Amino Acid) | ALPAPPAPPRSASPKDRKPGIARQILHNLNIFSNNNKSPGGGARDSECTSTGSGGGRRHS
VDTVSTYLSHESKDSLQQAAVGELLNCSGGSDDVFESPAPSADELDLSDETVDESWWAAV
REWTRRGAPRGPC
(43 a.a.) |