SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1092_5prime_partial:A_BomoEE_comp24329_c0_seq1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		PREDICTED:_homeotic_protein_distal-less_isoform_X5_[Bombyx_mori]
Ontology
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007449 P proximal/distal pattern formation, imaginal disc
GO:0007469 P antennal development
GO:0007479 P leg disc proximal/distal pattern formation
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007485 P imaginal disc-derived male genitalia development
GO:0007487 P analia development
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0010092 P specification of animal organ identity
GO:0010629 P negative regulation of gene expression
GO:0016319 P mushroom body development
GO:0021553 P olfactory nerve development
GO:0035114 P imaginal disc-derived appendage morphogenesis
GO:0035215 P genital disc development
GO:0042048 P olfactory behavior
GO:0043565 F sequence-specific DNA binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048264 P determination of ventral identity
GO:0048728 P proboscis development
RNA-seq EntryA_BomoEE_comp24329_c0_seq1
Sequence
(Amino Acid)
RRSKYKKMMKAAQVGAPPPSLGLPPGSPPSNNQLLHGGGGSSSGSQHSPSAYQSGGPTQA
HSPTPSSTPVSELSPGLSPTGTHWDVKQPPQASWDVKVGYPTAGRSPDGSSCDVKPPHQQ
SWDPRVGYEGYFAQTEDIEGSPSVDGARRPMPWMLKGAPPGPWDMKGAHAHALHHQGAPQ
PHPPYVPQYSWYQTDANPGLLTLYSQGMAGSLAHYGHRNE
*(72 a.a.)

- SilkBase 1999-2023 -