SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE1084_internal:A_BomoEE_comp24107_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
PREDICTED:_contactin-associated_protein-like_5_[Bombyx_mori]
Ontology
GO:0003015 P heart process
GO:0004888 F transmembrane signaling receptor activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005918 C septate junction
GO:0005919 C pleated septate junction
GO:0007155 P cell adhesion
GO:0007163 P establishment or maintenance of cell polarity
GO:0007165 P signal transduction
GO:0007391 P dorsal closure
GO:0008039 P synaptic target recognition
GO:0008065 P establishment of blood-nerve barrier
GO:0008104 P protein localization
GO:0008366 P axon ensheathment
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016080 P synaptic vesicle targeting
GO:0016081 P synaptic vesicle docking
GO:0019991 P septate junction assembly
GO:0021682 P nerve maturation
GO:0030054 C cell junction
GO:0035151 P regulation of tube size, open tracheal system
GO:0045216 P cell-cell junction organization
GO:0048786 C presynaptic active zone
GO:0060857 P establishment of glial blood-brain barrier
GO:0061343 P cell adhesion involved in heart morphogenesis
GO:0072553 P terminal button organization
GO:0097105 P presynaptic membrane assembly
RNA-seq EntryA_BomoEE_comp24107_c0_seq1
Sequence
(Amino Acid)
FRSGGYVGCVRGFKISDHVVDLSRKAQDNVDQDLTGVLPECNMKCDSEPCKNGGVCTEDF
TNQESSCDCELTSYFGEYCMEEKGADFNGESILQRKFVHSNTVPIS
(34 a.a.)

- SilkBase 1999-2023 -