SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE1076_complete:A_BomoEE_comp24013_c0_seq2
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)
aldehyde_oxidase_1_[Bombyx_mori]
Ontology
GO:0000302 P response to reactive oxygen species
GO:0003824 F catalytic activity
GO:0004854 F xanthine dehydrogenase activity
GO:0005506 F iron ion binding
GO:0005829 C cytosol
GO:0006145 P purine nucleobase catabolic process
GO:0009055 F electron transfer activity
GO:0009115 P xanthine catabolic process
GO:0009414 P response to water deprivation
GO:0016491 F oxidoreductase activity
GO:0016614 F oxidoreductase activity, acting on CH-OH group of donors
GO:0016903 F oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0042554 P superoxide anion generation
GO:0046110 P xanthine metabolic process
GO:0046872 F metal ion binding
GO:0050660 F flavin adenine dinucleotide binding
GO:0051536 F iron-sulfur cluster binding
GO:0051537 F 2 iron, 2 sulfur cluster binding
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomoEE_comp24013_c0_seq2
Sequence
(Amino Acid)
MGLGYWTSEKLMYDSATGKLLTDRTWNYKPPGIKDIPADMRIYFRRNARNEFGVLQSKAT
GEPSFCLAIGVTHAIREAIRSSRLDAGYEDKWLDIDLPFTVENIFMAAGNVIEHFKLT
*(38 a.a.)

- SilkBase 1999-2023 -