SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1073_internal:A_BomoEE_comp23970_c0_seq2
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		Tyrosine-protein_kinase_RYK_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0007416 P synapse assembly
GO:0007435 P salivary gland morphogenesis
GO:0007482 P haltere development
GO:0007611 P learning or memory
GO:0007613 P memory
GO:0008355 P olfactory learning
GO:0010906 P regulation of glucose metabolic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0016199 P axon midline choice point recognition
GO:0016203 P muscle attachment
GO:0016204 P determination of muscle attachment site
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016319 P mushroom body development
GO:0016740 F transferase activity
GO:0017147 F Wnt-protein binding
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019901 F protein kinase binding
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030424 C axon
GO:0030425 C dendrite
GO:0042803 F protein homodimerization activity
GO:0042813 F Wnt-activated receptor activity
GO:0043235 C receptor complex
GO:0046982 F protein heterodimerization activity
GO:0061643 P chemorepulsion of axon
GO:0070983 P dendrite guidance
RNA-seq EntryA_BomoEE_comp23970_c0_seq2
Sequence
(Amino Acid)
LTDFILTFVNKNVLFLFSGLDAELYYVREGVVNTYATSFIVPVPAHIADLEFMWQALGRT
PLPYVMAIEYEARGAMLPPQVNISERGYVPTTLQTFRIRLPCTGTRSAENLVTIQLNISV
PDRAHNDIRLTFKRNKICLKGLATIVTHNESARLAGDASRGPSGVLFAAGGCGAAALELL
AAAAAAGTLY
(62 a.a.)

- SilkBase 1999-2023 -