SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE10549_3prime_partial:A_BomoEE_comp64292_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		PREDICTED:_lysosomal-trafficking_regulator-like_[Papilio_machaon]
Ontology
GO:0002446 P neutrophil mediated immunity
GO:0002456 P T cell mediated immunity
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006644 P phospholipid metabolic process
GO:0006810 P transport
GO:0007017 P microtubule-based process
GO:0007040 P lysosome organization
GO:0007596 P blood coagulation
GO:0015031 P protein transport
GO:0015630 C microtubule cytoskeleton
GO:0030595 P leukocyte chemotaxis
GO:0032438 P melanosome organization
GO:0032510 P endosome to lysosome transport via multivesicular body sorting pathway
GO:0032816 P positive regulation of natural killer cell activation
GO:0033299 P secretion of lysosomal enzymes
GO:0033364 P mast cell secretory granule organization
GO:0042267 P natural killer cell mediated cytotoxicity
GO:0042493 P response to xenobiotic stimulus
GO:0042742 P defense response to bacterium
GO:0042832 P defense response to protozoan
GO:0043473 P pigmentation
GO:0048753 P pigment granule organization
GO:0051607 P defense response to virus
GO:0055091 P phospholipid homeostasis
RNA-seq EntryA_BomoEE_comp64292_c0_seq1
Sequence
(Amino Acid)
MPDRTFHSLATTWRLITKDSPTDVKELIPELFYLPELFYNNEGLNLGIRQCGEGIDEVEL
PPWAADARLFTLLHRQALEAAHVSETLPHWIDLVFGHKQTGPAALDAINVFPACTYYGFD
PDALEDEVDRSAACAMVRTYGQVPRRLLRQPHPHAAIELYP
(52 a.a.)

- SilkBase 1999-2023 -