SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoEE1046_5prime_partial:A_BomoEE_comp23422_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		D-serine/D-alanine/glycine_transporter_[Propionibacterium_acnes_JCM_18916]
Ontology
GO:0001761 F beta-alanine transmembrane transporter activity
GO:0001762 P beta-alanine transport
GO:0003333 P amino acid transmembrane transport
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006865 P amino acid transport
GO:0015171 F amino acid transmembrane transporter activity
GO:0015180 F L-alanine transmembrane transporter activity
GO:0015187 F glycine transmembrane transporter activity
GO:0015297 F antiporter activity
GO:0015808 P L-alanine transport
GO:0015816 P glycine transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0042891 P obsolete antibiotic transport
GO:0042895 F obsolete antibiotic transmembrane transporter activity
GO:0042941 P D-alanine transport
GO:0042942 P D-serine transport
GO:0042944 F D-alanine transmembrane transporter activity
GO:0042945 F D-serine transmembrane transporter activity
GO:0055085 P transmembrane transport
RNA-seq EntryA_BomoEE_comp23422_c0_seq1
Sequence
(Amino Acid)
APRAFGKLSRHGVPGWGLFCTIILIGSALILAAKDSVMGAFTLVTTVSAVLFVFVWSMIL
ISHIVHVRRNPQAHAKSIYPMPGASFMPWVVLAFFVFVIVLLTGADDTLQALLATPIWFV
VLGIVWAIVRRRSHHDDLETDLPAD
*(47 a.a.)

- SilkBase 1999-2023 -