SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE10407_complete:A_BomoEE_comp64194_c0_seq2
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
PREDICTED:_palmitoyl-protein_thioesterase_1_[Papilio_polytes]
Ontology
GO:0002084 P protein depalmitoylation
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005764 C lysosome
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006898 P receptor-mediated endocytosis
GO:0006907 P pinocytosis
GO:0007040 P lysosome organization
GO:0007042 P lysosomal lumen acidification
GO:0007268 P chemical synaptic transmission
GO:0007269 P neurotransmitter secretion
GO:0007399 P nervous system development
GO:0007420 P brain development
GO:0007601 P visual perception
GO:0007625 P grooming behavior
GO:0008021 C synaptic vesicle
GO:0008306 P associative learning
GO:0008344 P adult locomotory behavior
GO:0008474 F palmitoyl-(protein) hydrolase activity
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016042 P lipid catabolic process
GO:0016290 F palmitoyl-CoA hydrolase activity
GO:0016787 F hydrolase activity
GO:0030149 P sphingolipid catabolic process
GO:0030163 P protein catabolic process
GO:0030308 P negative regulation of cell growth
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031579 P membrane raft organization
GO:0032429 P regulation of phospholipase A2 activity
GO:0035338 P long-chain fatty-acyl-CoA biosynthetic process
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043066 P negative regulation of apoptotic process
GO:0043202 C lysosomal lumen
GO:0043524 P negative regulation of neuron apoptotic process
GO:0044257 P cellular protein catabolic process
GO:0044265 P cellular macromolecule catabolic process
GO:0045121 C membrane raft
GO:0045202 C synapse
GO:0048260 P positive regulation of receptor-mediated endocytosis
GO:0048549 P positive regulation of pinocytosis
GO:0048666 P neuron development
GO:0050803 P regulation of synapse structure or activity
GO:0050896 P response to stimulus
GO:0051181 P obsolete cofactor transport
GO:0051186 P obsolete cofactor metabolic process
GO:0070062 C extracellular exosome
GO:0098599 F palmitoyl hydrolase activity
RNA-seq EntryA_BomoEE_comp64194_c0_seq2
Sequence
(Amino Acid)
MRLWLIPLLLIKLISATPTPIVLWHGMGDTCCMSFSLGSFKIFLEKNIPGVYVLSLQIGN
NTVEDFENGYFMNPNLQVEYVCEKLAADPKLSNGFNVMGFSQGCQFIWVQNSLVQATYWH
DPLDERTYEANSVFLADINNVRTVNKTYIQNLNNLERFVLVMFDNDSIVQPKETEWFGFY
APGQAEKLVSLRESKIYLQDRLGLKKMDKAGKLIFLSTPGDHLRFTEEWMIKNIIKPYLS
S
*(79 a.a.)

- SilkBase 1999-2023 -