SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoEE10262_complete:A_BomoEE_comp64057_c0_seq3
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
PREDICTED:_tyrosine-protein_kinase_CSK_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001817 P regulation of cytokine production
GO:0002250 P adaptive immune response
GO:0002376 P immune system process
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007417 P central nervous system development
GO:0007420 P brain development
GO:0008285 P negative regulation of cell population proliferation
GO:0010989 P negative regulation of low-density lipoprotein particle clearance
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0019903 F protein phosphatase binding
GO:0030154 P cell differentiation
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0032715 P negative regulation of interleukin-6 production
GO:0033673 P negative regulation of kinase activity
GO:0034236 F protein kinase A catalytic subunit binding
GO:0034332 P adherens junction organization
GO:0035556 P intracellular signal transduction
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042802 F identical protein binding
GO:0042997 P negative regulation of Golgi to plasma membrane protein transport
GO:0043406 P positive regulation of MAP kinase activity
GO:0045087 P innate immune response
GO:0045121 C membrane raft
GO:0045779 P negative regulation of bone resorption
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0048709 P oligodendrocyte differentiation
GO:0050765 P negative regulation of phagocytosis
GO:0050863 P regulation of T cell activation
GO:0060368 P regulation of Fc receptor mediated stimulatory signaling pathway
GO:0070062 C extracellular exosome
GO:0070064 F proline-rich region binding
GO:0070373 P negative regulation of ERK1 and ERK2 cascade
GO:0071375 P cellular response to peptide hormone stimulus
RNA-seq EntryA_BomoEE_comp64057_c0_seq3
Sequence
(Amino Acid)
MNSDVHRHQAHPPLAQHGVHGAAQGVGPCGWYSASAAPAPTAPARLKRVQAPHQLPSGGN
LSGSNGPHAPLSPSALQNTIPHNLIMSSSVRTPAPAATVPSAMHTSQTAPAVTKGQSDVL
VNSSVQNPPPAGNRLVNMTQWPWHHGAISRERAEALLSGSPDGVFLVRESTNFPGDHTLC
VRFRGRVEHYRVKWATAPDNQNQRLTIDDEEFFDNMTDLIHHYLQDADGLCTKLVRCLPK
ATANGTNNNGAPQQQYPPHPQQPPPYPPTPSVPSALAAGHFPHAYVAPAASTDQTDGTLQ
SQSFVDARWKIDERDLEIRENIGKGEFGDVMLGILNGTQKVAVKILKDREAASKFRAEAS
VMASLKHENLVRLLGLVFTSSGGTCLVTEHCAQGSLLDYLRSRGRHYVTQLNQINFAFDA
CCGMEYLERQRVVHRDLAARNVLISAEGTAKVADFGLARAGAALEDPAEAARLQAKLPIK
WTAPEALKYNKFSNKSDMWSFGILLWEIYSFGRVPYPRIPLAEVVRHVERGYRMEAPEGC
PPGPYELMRAAWHADPASRPTFLHMRRNLADIRDHTPAQVRPSLPYR
*(195 a.a.)

- SilkBase 1999-2023 -