SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR95309_internal:A_BomoBR_DN14333_c0_g2_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
uncharacterized_protein_LOC101737074_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000987 F cis-regulatory region sequence-specific DNA binding
GO:0000988 F obsolete transcription factor activity, protein binding
GO:0001076 F obsolete transcription factor activity, RNA polymerase II transcription factor binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001085 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001228 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001541 P ovarian follicle development
GO:0001658 P branching involved in ureteric bud morphogenesis
GO:0001666 P response to hypoxia
GO:0001701 P in utero embryonic development
GO:0001702 P gastrulation with mouth forming second
GO:0001822 P kidney development
GO:0003190 P atrioventricular valve formation
GO:0003198 P epithelial to mesenchymal transition involved in endocardial cushion formation
GO:0003251 P positive regulation of cell proliferation involved in heart valve morphogenesis
GO:0003279 P cardiac septum development
GO:0003360 P brainstem development
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005518 F collagen binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006879 P cellular iron ion homeostasis
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007183 P SMAD protein complex assembly
GO:0007283 P spermatogenesis
GO:0007338 P single fertilization
GO:0007369 P gastrulation
GO:0007411 P axon guidance
GO:0007492 P endoderm development
GO:0007498 P mesoderm development
GO:0008283 P cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0008584 P male gonad development
GO:0008585 P female gonad development
GO:0009952 P anterior/posterior pattern specification
GO:0010718 P positive regulation of epithelial to mesenchymal transition
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0014033 P neural crest cell differentiation
GO:0017015 P regulation of transforming growth factor beta receptor signaling pathway
GO:0030308 P negative regulation of cell growth
GO:0030509 P BMP signaling pathway
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0030513 P positive regulation of BMP signaling pathway
GO:0030616 F obsolete transforming growth factor beta receptor, common-partner cytoplasmic mediator activity
GO:0032444 C activin responsive factor complex
GO:0032525 P somite rostral/caudal axis specification
GO:0032909 P regulation of transforming growth factor beta2 production
GO:0033686 P positive regulation of luteinizing hormone secretion
GO:0035556 P intracellular signal transduction
GO:0036302 P atrioventricular canal development
GO:0042118 P endothelial cell activation
GO:0042127 P regulation of cell population proliferation
GO:0042177 P negative regulation of protein catabolic process
GO:0042733 P embryonic digit morphogenesis
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046881 P positive regulation of follicle-stimulating hormone secretion
GO:0046982 F protein heterodimerization activity
GO:0048589 P developmental growth
GO:0048663 P neuron fate commitment
GO:0048729 P tissue morphogenesis
GO:0048733 P sebaceous gland development
GO:0048859 P formation of anatomical boundary
GO:0051098 P regulation of binding
GO:0051571 P positive regulation of histone H3-K4 methylation
GO:0051797 P regulation of hair follicle development
GO:0060021 P roof of mouth development
GO:0060065 P uterus development
GO:0060391 P positive regulation of SMAD protein signal transduction
GO:0060395 P SMAD protein signal transduction
GO:0060548 P negative regulation of cell death
GO:0060956 P endocardial cell differentiation
GO:0061040 P female gonad morphogenesis
GO:0070102 P interleukin-6-mediated signaling pathway
GO:0070411 F I-SMAD binding
GO:0070412 F R-SMAD binding
GO:0071141 C SMAD protein complex
GO:0071559 P response to transforming growth factor beta
GO:0072133 P metanephric mesenchyme morphogenesis
GO:0072134 P nephrogenic mesenchyme morphogenesis
GO:0072520 P seminiferous tubule development
GO:0090575 C RNA polymerase II transcription regulator complex
GO:2000617 P positive regulation of histone H3-K9 acetylation
RNA-seq EntryA_BomoBR_DN14333_c0_g2_i1
Sequence
(Amino Acid)
RKSTLSRSSSMSTPSLGPFEAVTGSEMVSRRRILSRSRDNLSQTLTQEEEEDVWYQKDKL
YKEHIQEVLDKWTQIDDEIWAKVIVFEKNRRVAKAYARAPVLTINGSDDGFDGMRIGLCG
FDNPHRDQKTDELKRHVGQGVKIKMDDAGNILIRRYSKSSVFVKSTAASSNEETAIGQDI
LKLPGYSLEQEKIFKLFDMKKFQSNVNRELRRAYPDRRRLETQCLSAVAFVKSDNELLEC
PIWVLVINVVAMDMLKSKLPPIQRPMDIKNRPRIPIPDEDPYSIASSNVNGSGSSGSSGG
YGLGNGHNGHGVVAATREQLMMQMGQRRGERPPNLPP
(111 a.a.)

- SilkBase 1999-2023 -