SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR8713_complete:A_BomoBR_DN17795_c0_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
survivin-2_[Bombyx_mori]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0000910 P cytokinesis
GO:0004869 F cysteine-type endopeptidase inhibitor activity
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005814 C centriole
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005876 C spindle microtubule
GO:0005881 C cytoplasmic microtubule
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007049 P cell cycle
GO:0007059 P chromosome segregation
GO:0007067 P mitotic cell cycle
GO:0008017 F microtubule binding
GO:0008270 F zinc ion binding
GO:0010466 P negative regulation of peptidase activity
GO:0015631 F tubulin binding
GO:0030414 F peptidase inhibitor activity
GO:0030496 C midbody
GO:0031021 C interphase microtubule organizing center
GO:0031503 P protein-containing complex localization
GO:0031536 P positive regulation of exit from mitosis
GO:0031577 P spindle checkpoint signaling
GO:0032133 C chromosome passenger complex
GO:0042803 F protein homodimerization activity
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045931 P positive regulation of mitotic cell cycle
GO:0046872 F metal ion binding
GO:0048037 F obsolete cofactor binding
GO:0051301 P cell division
GO:0051303 P establishment of chromosome localization
RNA-seq EntryA_BomoBR_DN17795_c0_g1_i1
Sequence
(Amino Acid)
MENESSLLFLVEERIKTFKNWPFNDKNKCNVRNMAEAGFYSVATGVEDADAAKCFLCGKE
LDGWESTDDPWIEHKSHAAQCAFVQLGKKEDDLLLSENLSVIKQYMINETKQIGEIAKEK
IDKKAKSIQRKCLARK
*(44 a.a.)

- SilkBase 1999-2023 -