SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR74432_internal:A_BomoBR_DN10310_c0_g1_i2
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
Potassium/sodium_hyperpolarization-activated_cyclic_nucleotide-gated_channel_4_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0005216 F ion channel activity
GO:0005222 F intracellular cAMP-activated cation channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005248 F voltage-gated sodium channel activity
GO:0005249 F voltage-gated potassium channel activity
GO:0005267 F potassium channel activity
GO:0005272 F sodium channel activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0006814 P sodium ion transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030552 F cAMP binding
GO:0034765 P regulation of ion transmembrane transport
GO:0035725 P sodium ion transmembrane transport
GO:0042391 P regulation of membrane potential
GO:0043025 C neuronal cell body
GO:0044316 C cone cell pedicle
GO:0045202 C synapse
GO:0055085 P transmembrane transport
GO:0060078 P regulation of postsynaptic membrane potential
GO:0071805 P potassium ion transmembrane transport
GO:0072718 P response to cisplatin
GO:1903351 P cellular response to dopamine
RNA-seq EntryA_BomoBR_DN10310_c0_g1_i2
Sequence
(Amino Acid)
DLLNILTEELRNEITLHTCRVLVDKVTLFKDVPASAVGSVLGCLKPEVYLPNDPVLRAGD
DGNCMYFIDYGTVAIYSLKGVEVCHLEDGAHFGEVALLMRDSKRLVTVVAVEITQLYRLD
DIDFRQYVFTNQILFERIQTLASQRMHEAVLVDRQFQRDREKFNEKPIEFS
(56 a.a.)

- SilkBase 1999-2023 -