SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR52031_internal:A_BomoBR_DN14647_c0_g2_i1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)
angiotensin-converting_enzyme_[Bombyx_mori]
Ontology
GO:0001822 P kidney development
GO:0001974 P blood vessel remodeling
GO:0002003 P angiotensin maturation
GO:0002005 P angiotensin maturation
GO:0002019 P regulation of renal output by angiotensin
GO:0002446 P neutrophil mediated immunity
GO:0002474 P antigen processing and presentation of peptide antigen via MHC class I
GO:0003081 P regulation of systemic arterial blood pressure by renin-angiotensin
GO:0003779 F actin binding
GO:0004175 F endopeptidase activity
GO:0004180 F carboxypeptidase activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0007283 P spermatogenesis
GO:0008144 F obsolete drug binding
GO:0008217 P regulation of blood pressure
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008238 F exopeptidase activity
GO:0008240 F tripeptidyl-peptidase activity
GO:0008241 F peptidyl-dipeptidase activity
GO:0008270 F zinc ion binding
GO:0009897 C external side of plasma membrane
GO:0014910 P regulation of smooth muscle cell migration
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0019229 P regulation of vasoconstriction
GO:0031404 F chloride ion binding
GO:0031434 F mitogen-activated protein kinase kinase binding
GO:0031711 F bradykinin receptor binding
GO:0032943 P mononuclear cell proliferation
GO:0042312 P blood vessel diameter maintenance
GO:0042447 P hormone catabolic process
GO:0043171 P peptide catabolic process
GO:0046872 F metal ion binding
GO:0050435 P amyloid-beta metabolic process
GO:0050482 P arachidonic acid secretion
GO:0051019 F mitogen-activated protein kinase binding
GO:0060047 P heart contraction
GO:0060177 P regulation of angiotensin metabolic process
GO:0060218 P hematopoietic stem cell differentiation
GO:0061098 P positive regulation of protein tyrosine kinase activity
GO:0070062 C extracellular exosome
GO:0070573 F metallodipeptidase activity
GO:0071838 P cell proliferation in bone marrow
GO:1900086 P positive regulation of peptidyl-tyrosine autophosphorylation
GO:1902033 P regulation of hematopoietic stem cell proliferation
GO:1903597 P negative regulation of gap junction assembly
GO:2000170 P positive regulation of peptidyl-cysteine S-nitrosylation
RNA-seq EntryA_BomoBR_DN14647_c0_g2_i1
Sequence
(Amino Acid)
AVCRTMGAPYKELVEIENAAARRNGYKDIGESWREEQEIPNLKSFCRRLYKSIRPLYRTL
HGITRFFLRRHYGAIVEETGPIPAHLLGNLWSQNWEPLTDLIIKNTLNLDERIRRSNWTV
LHMAKRAEDFYQSLGLPPMTDTFWRESVLTREKHAHARCHGAAADMFKDGDFRLLYCS
(58 a.a.)

- SilkBase 1999-2023 -