| Name | O_BomoBR49387_internal:A_BomoBR_DN14910_c0_g1_i1 |
| Scaffold_id | Bomo_Chr14 |
NCBI non-redundant
(nr) | E3_ubiquitin-protein_ligase_SH3RF1_isoform_X2_[Bombyx_mori] |
| Ontology |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005829 |
C |
cytosol |
| GO:0006915 |
P |
apoptotic process |
| GO:0008270 |
F |
zinc ion binding |
| GO:0016567 |
P |
protein ubiquitination |
| GO:0016874 |
F |
ligase activity |
| GO:0030027 |
C |
lamellipodium |
| GO:0042995 |
C |
cell projection |
| GO:0043066 |
P |
negative regulation of apoptotic process |
| GO:0043154 |
P |
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| GO:0046328 |
P |
regulation of JNK cascade |
| GO:0046872 |
F |
metal ion binding |
| GO:0048471 |
C |
perinuclear region of cytoplasm |
| GO:2001237 |
P |
negative regulation of extrinsic apoptotic signaling pathway |
|
| RNA-seq Entry | A_BomoBR_DN14910_c0_g1_i1 |
Sequence
(Amino Acid) | GTDARARRRRRSRSSERPLPAHYVALYPYHPQKPDELELTKGVVYTVTERCRDGWYKGFS
ERSQRAGVFPGNYVAPHRAKHDKSVVSTVGTVPSLKAMTSGPPPPPDAPPRAPS
(37 a.a.) |
