| Name | O_BomoBR48880_5prime_partial:A_BomoBR_DN1388_c0_g1_i1 |
| Scaffold_id | Bomo_Chr4 |
NCBI non-redundant
(nr) | integrin_beta_pat-3-like,_partial_[Bombyx_mori] |
| Ontology |
| GO:0001618 |
F |
virus receptor activity |
| GO:0004872 |
F |
signaling receptor activity |
| GO:0005178 |
F |
integrin binding |
| GO:0006954 |
P |
inflammatory response |
| GO:0007155 |
P |
cell adhesion |
| GO:0007160 |
P |
cell-matrix adhesion |
| GO:0007229 |
P |
integrin-mediated signaling pathway |
| GO:0008305 |
C |
integrin complex |
| GO:0009897 |
C |
external side of plasma membrane |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016032 |
P |
viral process |
| GO:0043235 |
C |
receptor complex |
| GO:0046718 |
P |
viral entry into host cell |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomoBR_DN1388_c0_g1_i1 |
Sequence
(Amino Acid) | CYTTFAYKYQDGYGIELLIQKNKNCDENILKLGVIVSVTVILVGIGTLVVWKLMTKYHDR
KEYMELMKQYNPDQGARTNKLYIDPCVTFKNPSYRADPITES
*(33 a.a.) |
