| Name | O_BomoBR35917_internal:A_BomoBR_DN15210_c0_g2_i1 |
| Scaffold_id | Bomo_Chr10 |
NCBI non-redundant
(nr) | armadillo_repeat-containing_protein_gudu_[Bombyx_mori] |
| Ontology |
| GO:0003341 |
P |
cilium movement |
| GO:0003356 |
P |
regulation of cilium beat frequency |
| GO:0003674 |
F |
molecular_function |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005929 |
C |
cilium |
| GO:0005930 |
C |
axoneme |
| GO:0007368 |
P |
determination of left/right symmetry |
| GO:0007507 |
P |
heart development |
| GO:0021591 |
P |
ventricular system development |
| GO:0030030 |
P |
cell projection organization |
| GO:0036158 |
P |
outer dynein arm assembly |
| GO:0042995 |
C |
cell projection |
| GO:0097546 |
C |
ciliary base |
|
| RNA-seq Entry | A_BomoBR_DN15210_c0_g2_i1 |
Sequence
(Amino Acid) | YLSKMFYFYLRCIITSREELNQDELQYLDIARAGAKALWSMSASQRNREAMRKYGMIPLI
AKMLKTIHLDVAVPTVGLLQMCANETSFQLAIQTERMVND
(32 a.a.) |
