SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR32521_5prime_partial:A_BomoBR_DN14714_c0_g1_i2
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)
arylsulfatase_B_[Bombyx_mori]
Ontology
GO:0003824 F catalytic activity
GO:0003943 F N-acetylgalactosamine-4-sulfatase activity
GO:0004065 F arylsulfatase activity
GO:0005739 C mitochondrion
GO:0005764 C lysosome
GO:0005788 C endoplasmic reticulum lumen
GO:0005791 C rough endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0006687 P glycosphingolipid metabolic process
GO:0006914 P autophagy
GO:0007040 P lysosome organization
GO:0007041 P lysosomal transport
GO:0007417 P central nervous system development
GO:0007584 P response to nutrient
GO:0008152 P metabolic process
GO:0008484 F sulfuric ester hydrolase activity
GO:0009268 P response to pH
GO:0009986 C cell surface
GO:0010632 P regulation of epithelial cell migration
GO:0010976 P positive regulation of neuron projection development
GO:0016787 F hydrolase activity
GO:0030207 P chondroitin sulfate catabolic process
GO:0043202 C lysosomal lumen
GO:0043627 P response to estrogen
GO:0043687 P post-translational protein modification
GO:0046872 F metal ion binding
GO:0051597 P response to methylmercury
GO:0061580 P colon epithelial cell migration
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoBR_DN14714_c0_g1_i2
Sequence
(Amino Acid)
GKYPMRLGMHGSPLFNSEDRGIPLTERLLPSYLKELGYSTHLVGKWHVGMSREEFLPTSR
GYESHYGMRGGFIDYYTYTNIEMVSQRITRIYFLFIYCLDGWTSSQPTWC
*(36 a.a.)

- SilkBase 1999-2023 -