SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR20887_3prime_partial:A_BomoBR_DN14017_c0_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)
PREDICTED:_membrane-associated_guanylate_kinase,_WW_and_PDZ_domain-containing_protein_1_[Papilio_xuthus]
Ontology
GO:0002092 P positive regulation of receptor internalization
GO:0003094 P glomerular filtration
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005770 C late endosome
GO:0005886 C plasma membrane
GO:0005923 C bicellular tight junction
GO:0007165 P signal transduction
GO:0007399 P nervous system development
GO:0008285 P negative regulation of cell population proliferation
GO:0010976 P positive regulation of neuron projection development
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0019902 F phosphatase binding
GO:0030054 C cell junction
GO:0030159 F signaling receptor complex adaptor activity
GO:0030336 P negative regulation of cell migration
GO:0030425 C dendrite
GO:0031697 F beta-1 adrenergic receptor binding
GO:0032403 F protein-containing complex binding
GO:0032516 P positive regulation of phosphoprotein phosphatase activity
GO:0032926 P negative regulation of activin receptor signaling pathway
GO:0032947 F molecular adaptor activity
GO:0036057 C slit diaphragm
GO:0038180 P nerve growth factor signaling pathway
GO:0043005 C neuron projection
GO:0043113 P receptor clustering
GO:0043234 C protein-containing complex
GO:0045202 C synapse
GO:0046332 F SMAD binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051291 P protein heterooligomerization
GO:0051898 P negative regulation of protein kinase B signaling
GO:0060395 P SMAD protein signal transduction
GO:0070699 F type II activin receptor binding
GO:0071850 P regulation of cell cycle
GO:0072015 P glomerular visceral epithelial cell development
GO:1990090 P cellular response to nerve growth factor stimulus
RNA-seq EntryA_BomoBR_DN14017_c0_g1_i1
Sequence
(Amino Acid)
MAQSSVDSDRLSSAGISTHSSGTAGNVGGSVVGVRAGEPGQKRQDEDDYDLGPLPPMWEK
AFTPAGEVYFIDNNTGTSHWLDPRLARVRKHSLGECGEDELPYGWERVTDERYGSYYVDH
INRRTQYENPVLQARRLRAEKLAAENTTNGQSNGPTPGGELRGNRLTVNLTKGPQGLGFT
LIGAEGIPETEGYLQIRSIVPHSPAWIDGELRPGDVVVGVGNRGVRGLTHELVAQIFQSI
TPGTEVSLHLVRGYPLTFDSEDPNTRVLSTLAVDATAPPSSDAVAMQQLTRALRTRFNLD
SPNHETGAQSRDEPDSSPGAAHSPRRLLSRSFDLDELGGADA
(113 a.a.)

- SilkBase 1999-2023 -