SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoBR101048_complete:A_BomoBR_DN30726_c11_g1_i11
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		high-affinity_copper_uptake_protein_1_[Bombyx_mori]
Ontology
GO:0005375 F copper ion transmembrane transporter activity
GO:0005737 C cytoplasm
GO:0005770 C late endosome
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006825 P copper ion transport
GO:0006855 P xenobiotic transmembrane transport
GO:0006878 P cellular copper ion homeostasis
GO:0015088 F copper ion transmembrane transporter activity
GO:0015677 P copper ion import
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0035434 P copper ion transmembrane transport
GO:0043025 C neuronal cell body
GO:0055037 C recycling endosome
GO:0072719 P cellular response to cisplatin
GO:1902861 P copper ion import across plasma membrane
RNA-seq EntryA_BomoBR_DN30726_c11_g1_i11
Sequence
(Amino Acid)
MDEHHEHHNMDMGHAGHEHHGIDHSRHIGHQMPINGLLNSSYNRIVHNTDMNDHNVHTFS
GHGDHSSHNMGMSMTFHGGYIETILFSWWNVTEVGEFVGSFFAIFIIALLYEG
*(37 a.a.)

- SilkBase 1999-2023 -