SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR101021_5prime_partial:A_BomoBR_DN30774_c1_g6_i4
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)
GABA_transporter_[Bombyx_mori]
Ontology
GO:0005328 F neurotransmitter:sodium symporter activity
GO:0005332 F gamma-aminobutyric acid:sodium symporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006836 P neurotransmitter transport
GO:0007268 P chemical synaptic transmission
GO:0007612 P learning
GO:0009636 P response to toxic substance
GO:0009744 P response to sucrose
GO:0009986 C cell surface
GO:0010033 P response to organic substance
GO:0010243 P response to organonitrogen compound
GO:0010288 P response to lead ion
GO:0014054 P positive regulation of gamma-aminobutyric acid secretion
GO:0014070 P response to organic cyclic compound
GO:0014074 P response to purine-containing compound
GO:0015293 F symporter activity
GO:0015812 P gamma-aminobutyric acid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030424 C axon
GO:0032229 P negative regulation of synaptic transmission, GABAergic
GO:0032355 P response to estradiol
GO:0042220 P response to cocaine
GO:0043005 C neuron projection
GO:0046872 F metal ion binding
GO:0051260 P protein homooligomerization
GO:0051592 P response to calcium ion
GO:0051939 P gamma-aminobutyric acid import
GO:0055085 P transmembrane transport
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
RNA-seq EntryA_BomoBR_DN30774_c1_g6_i4
Sequence
(Amino Acid)
SDVAIKSNLPERESWASKLDFILSVVGLAIGLGNVWRFPYLCYKNGGGAFLIPYFLTLFL
AGIPMFFMELAMGQMLTIGGLGVFKIAPIFKGIGYAAAVMSCWMNVYYIVILAWAIFYFF
MSMRSDVPWRNCDNYWNTPSCVNPYDRKNLTCWSSKDMSTYCILNGKNFTKAMLSDPVKE
FWE
*(60 a.a.)

- SilkBase 1999-2023 -