SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR100959_complete:A_BomoBR_DN30771_c1_g4_i2
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)
serine/threonine-protein_kinase_PAK_mbt_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000187 P obsolete activation of MAPK activity
GO:0000278 P mitotic cell cycle
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005913 C adherens junction
GO:0006468 P protein phosphorylation
GO:0007010 P cytoskeleton organization
GO:0007030 P Golgi organization
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016319 P mushroom body development
GO:0016740 F transferase activity
GO:0017048 F small GTPase binding
GO:0018105 P peptidyl-serine phosphorylation
GO:0023014 P signal transduction
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0045315 P positive regulation of compound eye photoreceptor development
GO:0045792 P negative regulation of cell size
GO:0046331 P lateral inhibition
GO:0048749 P compound eye development
GO:2000047 P regulation of cell-cell adhesion mediated by cadherin
RNA-seq EntryA_BomoBR_DN30771_c1_g4_i2
Sequence
(Amino Acid)
MMNLRRQQRRELLFNEVVIMRDYPHPNIVEMYASYLVGDELWVVMEYMAGGALTDIVTRV
RMDPEQIATVCKQCLKALAFLHSQGVIHRDIKSDSILMTADGRVKLSDFGFCAQVSQELP
KRKSLVGTPYWMSPEVISRLPYGPEVDVWSLGIMVVEMVDGEPPFFNEPPLQAMRRIRDM
PAPRPRGAARCPADLLAFVESALVRDPALRLSAPRLLSHAFLRRAGPPALLVPLMHAP
*(78 a.a.)

- SilkBase 1999-2023 -